PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00128.1.g00870.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 323aa    MW: 33791.8 Da    PI: 8.4912
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00128.1.g00870.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.46.5e-38103160562
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +l+cprCds+ntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+ 
  Zjn_sc00128.1.g00870.1.am.mk 103 TLRCPRCDSANTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRA 160
                                   679**************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3185158IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.273104158IPR003851Zinc finger, Dof-type
PfamPF027011.4E-31104158IPR003851Zinc finger, Dof-type
PROSITE patternPS013610106142IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAFSLPILLD PPSWDQMQMQ QQRSLQCLLG GGSDHHQLMP SPAGLAPLPD GPPDTAARAP  60
AGGVSSTSLQ QQATAETAQQ SRQGVSMAER ARLARVPLPE PGTLRCPRCD SANTKFCYFN  120
NYSLSQPRHF CKACRRYWTR GGALRNVPVG GGCRRNTKRA SKKASRQGAA GGATAASSSS  180
STTTTSTTVT TTTTSSAAAA EVLASMHAQL PHLGLPPAAA LEASLEGYHH YLPLQMQQQF  240
LQQGLDGYHF TDGDGGGVFA DGLPRGVASG LLAQLAAVKM EGHNNGGAVA AAHEQSYWPG  300
SGGNEWPTEF LSGFSLSSSG NVL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824191e-145KC582419.1 Sorghum bicolor dof28 protein (dof28) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008668091.11e-124PREDICTED: uncharacterized protein LOC100273972 isoform X1
TrEMBLB6U2U91e-133B6U2U9_MAIZE; Putative uncharacterized protein
STRINGGRMZM2G176063_P011e-119(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.13e-39Dof family protein